PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.308240.1
Common NameCsa_5G623500, LOC101222167
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 1651aa    MW: 179574 Da    PI: 6.2924
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.308240.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.1e-089871028245
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        +WT eE + + +av  +G++ ++ I+r++   +++ qck ++ 
   Cucsa.308240.1  987 SNWTDEEKLVFMQAVSSYGKD-FDMISRCIR-SKSRDQCKIFFS 1028
                       58*****************99.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.57E-12757819IPR009057Homeodomain-like
PROSITE profilePS5129313.656769820IPR017884SANT domain
SMARTSM007173.1E-5770818IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-59811029IPR009057Homeodomain-like
SuperFamilySSF466892.57E-109831035IPR009057Homeodomain-like
PROSITE profilePS5129311.6229841035IPR017884SANT domain
SMARTSM007172.9E-69851033IPR001005SANT/Myb domain
PfamPF002496.7E-69881027IPR001005SANT/Myb domain
CDDcd001672.23E-59881027No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1651 aa     Download sequence    Send to blast
MPPEPLPWDR KDLFKERKHE KSEAIGSAAR WRDSYHGSRE FNRWGSADLR RPTGHGKQGG  60
WHQFSEDSSH GYGPSRSFSD RVIEDESFRP SVPRGDGKYI RIGRESRGSF SHRDWRSHSR  120
DANNGFGNPS RRTSSQDVSS DQRSVDDTVT YSSPQSFHGL ENGPRSDVEV SLGSTDWKPL  180
KWSRSGSLSS RGSAYSSSTN SKNEKADLPL RVASPIESPS AEATACVTSS LPSEDAISRK  240
KPRLGWGDGL AKYEKEKVEV PDGSLRKEVA LLSSGSGELT HSLGSNFAEK SPKTLPFSDC  300
ASPATPSSFA CSSSSGLEDK PFSKGAGADG MICSSPGSGS QNLQKLLCSI EKMEISSVAN  360
LGSSLVELFH SDDPNTIESC FGKSTLNKLL AYKGEISKTL EMTESEIDSL ENELKSLKSV  420
NGGNVSHKKS CSATRVMESS TYFKEQDGIS CIATRPAPLV VVSSSDATVE KVPLCKGDVG  480
VEDVDTKADE IDSPGTVTSK FNEPSRVVKA IASDIVDNGH CSVVTDAIVP GKMEGSFPIS  540
GPFVDEHETI GSGNECTLAK SCTSESVYGD LMAQAGSRSS LCDSIFACNK EYASRAAEVI  600
FKRSPVGMCK ISSKSTKNVS CSETEKLIKE KFVMRKKFLK FKESALTLRF KSLQQSWKEG  660
LLHSVKKCRS RPQKKELSLR VTHSGHQKYR SSSIRSRLVQ QGACQSSTFN TEIAVRHSSK  720
LLLNPQIKLY RNTLKMPAMI LDKKEKIALR FISHNGLVED PCAVEKERNL INPWTSAEKE  780
IFWEKLSLFG KDFKKISSFL DLKTTADCIQ FYYKNHKSDS FKKNKNLELG KQMKSSAITY  840
LVTSGKKWNP DANATSLDIL GVASVMAAQA DYDIENQQKC TRHLGVGRDV ESKVSWSASS  900
PNKSNLDDLQ TEKETVAADV LAGISGSISS EALSSCITSA IDPREELRER KCYKVDFAAK  960
LPSLSDVMQK TDNEPCSDDS SEDVDSSNWT DEEKLVFMQA VSSYGKDFDM ISRCIRSKSR  1020
DQCKIFFSKA RKCLGLDLMH TSGDVGETPG NGNDASGSGS GTDTEEHCVV EICEGRGSDE  1080
FISKSINGGS TSVNINHEET VSAVTDNMRT SMEFEESTAL QQSDEKGAEA VGNLIFETLK  1140
EEDVPNPSQP THDHKIEGSS ENTESGKSCN EPDILRSESV STVDENSAAV SEGRATVKLA  1200
IGEEEVGSDT NLHGQSTILC SGQDSTGNDS NIALEGSSVG LDPHILHPNI LKVEPVEKKS  1260
CIKSEENFLS VRNSDTGVIG REQMLNQDIS SSTLILQEIS DANQKPMNRD DDAEHPNNLL  1320
CNSESSTFPR SYPFNKQIFE DINRNINHAY FRVQGLSKPD INCNSKYVSE GQFLQNCNSS  1380
KPHNLAEPPF LSQNIELGHD HQKNASGSGS ASDSDVPCRK GDVKLFGQIL SHAPSQQNSS  1440
SGSNECGEKK GPLHNSSSKS CDMGENIPLR SYGFWDGSRI QTGLSALPDS AILQAKYPAA  1500
FSGYSATSVK TEQQPLQALS NNGDQSLNEL VSAFPTKDGV VDYHSHRSRD GVKMRPFPVD  1560
IFSEMHRRNG FDAVSLSSLQ QQGRVLVGMN VVGRGGILMG GSCTGVSDPV AAIKMHYAKA  1620
DQYAGQPASM FTREDGSWRG GGNGGDLGSR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-16731822494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-16731822494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004142488.10.0PREDICTED: uncharacterized protein LOC101222167
TrEMBLA0A0A0KWU70.0A0A0A0KWU7_CUCSA; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-102MYB family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]